PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G017000.1.p
Common NameGLYMA_12G017000, LOC547488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 353aa    MW: 39518.3 Da    PI: 6.0808
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G017000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.77.5e-201562148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd +lvd+++++G g+W++ +++ g++R++k+c++rw +yl
  Glyma.12G017000.1.p 15 KGPWTPEEDRILVDYIQKHGHGSWRALPKHAGLNRCGKSCRLRWTNYL 62
                         79********************************************97 PP

2Myb_DNA-binding56.85.1e-1868113148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++++eE++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Glyma.12G017000.1.p  68 RGKFSEEEEQLIINLHAVLGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 113
                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26665IPR009057Homeodomain-like
PROSITE profilePS5129419.3471062IPR017930Myb domain
SuperFamilySSF466891.83E-3212109IPR009057Homeodomain-like
SMARTSM007171.2E-161464IPR001005SANT/Myb domain
PfamPF002493.2E-181562IPR001005SANT/Myb domain
CDDcd001672.40E-131762No hitNo description
PROSITE profilePS5129427.68563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2866117IPR009057Homeodomain-like
SMARTSM007174.0E-1767115IPR001005SANT/Myb domain
PfamPF002499.8E-1768113IPR001005SANT/Myb domain
CDDcd001674.66E-1370113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MMGRTPCSDE NGLKKGPWTP EEDRILVDYI QKHGHGSWRA LPKHAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEEQLII NLHAVLGNKW SAIAGHLPGR TDNEIKNFWN THLKKKLLQM  120
GLDPVTHRPR SDHLNLLSNL QQLLAATNIV SNLTNTWDTN NALRLQSDAT QLAKLQLLQN  180
ILHVLGDTTP TSNLDLLNPF GPSSSSLPDG FLNEVLGLNQ SKLQNLYNGY SAQNQPNLQS  240
FEPPHQQQVL PTGNQHMDGG SIDSSCMKPE KGDEQLDVPY SSSTPFNSLP NLVSASPECS  300
THVLMQMENK VMPNECSDPS SSTSTNFEMW GDFMYEEVSD AYWKDLIDKE TN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30131175108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.113430.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086510.0AB108651.1 Glycine max MYB101 mRNA for transcription factor MYB101, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592013.20.0PREDICTED: transcription factor MYB39
TrEMBLI1LP670.0I1LP67_SOYBN; Uncharacterized protein
STRINGGLYMA12G01960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-100myb domain protein 9